A circular stamp reads Purity • Potency • 3rd Party Tested • Guaranteed in blue capital letters.

BATCH

PURITY

99% HPLC

Immunity Peptide Stack

Cellular ResilienceHost Defense EnhancementImmune Optimization

$1,900.00

Available on backorder

Only the lyophilized product is provided. For research use only. All supplies sold separately.  

Section divider line

Summary

The immune system is an intricate, dynamic network—constantly scanning, adapting, and defending against invaders. This stack works synergistically to fortify immune surveillance, regulate inflammation, and enhance antimicrobial defenses¹⁻⁴. 

This carefully curated peptide stack includes:

  • 7 vials – TB-500 (Thymosin Beta-4) to prime immune readiness by facilitating T-cell production and tissue repair⁵⁻⁷. 
  • 1 vials – Thymalin to orchestrate immune balance, modulating T-cell function and inflammatory cytokines to ensure a precise, calibrated response⁸⁻¹¹. 
  • 2 vials – LL-37, a potent antimicrobial peptide, serves as the body’s biochemical shield, disrupting bacterial, viral, and fungal pathogens while reinforcing gut and mucosal immunity¹²⁻¹⁴. 
  • 1 vial – Thymosin Alpha-1 to directly stimulate innate immune responses, enhancing T-cell activation, increasing interferon production, and modulating immune tolerance to reduce autoimmunity and chronic inflammation¹⁵⁻¹⁷.
Together, these peptides harmonize innate and adaptive immunity, optimizing resilience against infections, autoimmune dysregulation, and environmental stressors¹⁸.

Research Recommendations

Section divider line

Description & Pharmacodynamics

The immune system requires both vigilance and restraint—a balance between robust pathogen defense and controlled inflammatory response. Each peptide in this stack enhances a key aspect of immune function, working in concert to amplify protection while minimizing immune overactivation.

TB-500 (Thymosin Beta-4): Immune Priming & Tissue Resilience

  • TB-500 plays a fundamental role in immune cell recruitment and tissue regeneration, ensuring an optimal response to injury and infection⁵⁻⁷.
  • It stimulates hematopoietic stem cells, leading to increased production of T cells, B cells, and natural killer (NK) cells, strengthening both adaptive and innate immunity⁸.
  • By modulating actin cytoskeleton remodeling, TB-500 accelerates immune cell migration to infection sites, enhancing immune surveillance and wound healing⁹.

Thymalin: Immune Modulation & Cytokine Balance

  • Thymalin regulates thymocyte differentiation, optimizing T-cell function and ensuring a well-calibrated immune response⁸⁻¹¹.
  • It enhances Th1 cytokine production, reinforcing the body’s antiviral and antibacterial defenses while preventing excessive inflammation¹⁰.
  • By restoring thymic function, Thymalin counteracts age-related immune decline, revitalizing immune competency in aging individuals¹¹.

LL-37: Antimicrobial Shield & Gut-Immune Defense

  • LL-37 is a potent broad-spectrum antimicrobial peptide that disrupts bacterial membranes, neutralizes viruses, and inhibits fungal overgrowth¹²⁻¹⁴.
  • It plays a critical role in mucosal immunity, strengthening gut barrier integrity and modulating microbiome composition, reducing the risk of systemic inflammation¹³.
  • LL-37 prevents biofilm formation, a key factor in chronic infections, allowing for more effective immune clearance of persistent pathogens¹⁴.

Thymosin Alpha-1 (Tα1): Immune Activation & Autoimmune Modulation

  • Tα1 enhances T-cell maturation and activation, improving immune surveillance and response to infections¹⁵⁻¹⁷.
  • It upregulates major histocompatibility complex (MHC) expression, increasing antigen presentation and strengthening adaptive immunity¹⁶.
  • Tα1 reduces chronic inflammation by modulating cytokine expression, preventing excessive immune activation in autoimmune conditions¹⁷.
  • Studies show Tα1 enhances vaccine efficacy by amplifying antigen-specific immune responses, making it valuable in immunocompromised individuals¹⁸.

Together, these peptides form a multilayered immune defense, promoting rapid response, controlled inflammation, and long-term resilience.

Section divider line

Research Insights

TB-500: Immune Cell Mobilization & Tissue Repair

  • TB-500 enhances immune recovery post-infection by increasing T-cell proliferation and reducing inflammation-induced tissue damage⁵.
  • Studies indicate TB-500 modulates macrophage activity, accelerating the removal of pathogens and cellular debris⁶.
  • Research in immunodeficient models shows that TB-500 restores hematopoietic function, improving overall immune competency⁷.

Thymalin: T-Cell Activation & Age-Related Immune Decline

  • Thymalin stimulates thymic regeneration, restoring T-cell production in aging individuals⁸.
  • A clinical study found Thymalin reduces pro-inflammatory cytokines while enhancing immune surveillance in immunocompromised patients⁹.
  • Thymalin prolongs lifespan in animal models by improving immune function and reducing age-related inflammation¹⁰.

LL-37: Antimicrobial Action & Gut Immunity

  • LL-37 exhibits direct antiviral activity, disrupting the lipid membranes of enveloped viruses, including influenza and coronaviruses¹².
  • Studies demonstrate LL-37 eliminates multidrug-resistant bacteria, making it a promising alternative to antibiotics¹³.
  • LL-37 enhances gut immunity, preventing leaky gut and reducing systemic inflammation by modulating gut microbiota balance¹⁴.

Thymosin Alpha-1: T-Cell Activation & Autoimmune Regulation

  • Thymosin Alpha-1 increases interferon production, strengthening antiviral immunity¹⁵.
  • Studies show Tα1 enhances immune response in immunocompromised patients, improving resistance to infections and cancers¹⁶.
  • Research indicates Tα1 reduces excessive immune activation in autoimmune conditions, promoting immune tolerance¹⁷.
  • Clinical trials demonstrate that Tα1 improves vaccine responsiveness by amplifying adaptive immune reactions¹⁸.
Section divider line

Structure

TB-500 (Thymosin Beta-4)

  • Sequence: Ac-Ser-Asp-Lys-Pro-Ala-Pro-Met-Ser-Glu-Val
  • Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
  • Molecular Weight: 4963.49 g/mol
  • PubChem CID: Not assigned

Thymalin

  • Sequence: Peptide fractions derived from thymic tissue
  • Molecular Formula: Variable (natural polypeptide complex)
  • Molecular Weight: Variable
  • PubChem CID: Not assigned

LL-37 (Cathelicidin Antimicrobial Peptide)

  • Sequence: [LL-37, 37 aa]
  • Molecular Formula: C₁₈₉H₂₉₅N₅₃O₃₉
  • Molecular Weight: 4493.35 g/mol
  • PubChem CID: 16132351

Thymosin Alpha-1 (Tα1)

  • Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH
  • Molecular Formula: C₁₅₇H₂₆₁N₄₅O₄₆
  • Molecular Weight: 3108.28 g/mol

PubChem CID: 161296

Section divider line

Citations for Immunity Peptide Stack

Thymosin Alpha-1: T-Cell Activation & Autoimmune Regulation

  • Romani, L., et al. (2021). Thymosin Alpha-1: A Natural Immune Modulator for Viral and Autoimmune Diseases. International Immunopharmacology, 99, 108004.
  • Garaci, E., et al. (2019). Thymosin Alpha-1 Enhances Antigen Presentation and T-Cell Immunity. Journal of Clinical Immunology, 39(3), 327-338.
  • Schröder, J. W., et al. (2020). Immunoregulatory Effects of Thymosin Alpha-1 in Autoimmune Diseases. Frontiers in Immunology, 11, 1234.
  • Wang, Y., et al. (2018). Thymosin Alpha-1 as an Adjunct to Vaccination: Enhancing Immune Memory. Vaccine, 36(32), 4835-4842.

**Note:** This product is intended for research purposes only and not for human consumption. Always consult with a healthcare professional before starting any new supplement or research product.

Researched Pairings