0
$0.00
A clear glass vial with a gold cap, labeled IGF-1 LR3 1mg/2ml in green text and featuring a green symbol above the product name, stands against a plain background.
A circular stamp reads Purity • Potency • 3rd Party Tested • Guaranteed in blue capital letters.

BATCH

PURITY

99% HPLC

  • CAS #:
  • 946870-92-4
  • Formula:
  • C400H625N111O115S9
  • M.W.:
  • 9117.60 g·mol−1

IGF-1 LR3

PerformanceThe Growth-Promoting Peptide for Enhanced Recovery

$187.00

Volume Pricing Guide

QUANTITY PRICE PER
1 $187.00
2 - 4 $168.30
5 - 9 $158.95
10 - 14 $149.60
15 - 19 $140.25
20 + $130.90

Only the lyophilized product is provided. For research use only. All supplies sold separately.  

Section divider line

Summary

IGF-1 LR3 (Insulin-like Growth Factor-1 Long R3) is a synthetic peptide with powerful anabolic effects. IGF-1 LR3 stimulates muscle growth, accelerates recovery, and promotes cellular repair. It is widely studied for its ability to improve physical performance, support tissue regeneration, and optimize metabolic health.

Research Recommendations

  • Protocol: 15 units daily for 26 days.
  • Supplies: Recommended supplies for one full course, based on clinical protocols for research and educational use.
  • Peptide Vials
  • 2
  • Bags of Needles
  • 3
  • Alcohol pad Bundles
  • 3
  • Bacteriostatic Water
  • 1
Section divider line

Description & Pharmacodynamics

IGF-1 LR3 is a modified form of IGF-1, a naturally occurring growth factor structurally similar to insulin. It binds to IGF-1 receptors on cells, activating pathways that promote growth, repair, and metabolic efficiency¹. The LR3 modification extends its half-life to approximately 20-30 hours, allowing for sustained anabolic effects and better systemic distribution².

Unlike IGF-1, IGF-1 LR3 is less likely to bind to IGF-binding proteins (IGFBPs), which enhances its availability for cellular uptake³. This modification amplifies its ability to stimulate protein synthesis, promote cell division, and improve glucose metabolism⁴. Additionally, IGF-1 LR3 supports tissue repair by encouraging the proliferation of satellite cells and fibroblasts, making it highly beneficial for recovery from injuries and intense training sessions⁵.

Section divider line

Research Insights

Muscle Growth and Performance

  • Key Findings: IGF-1 LR3 enhances muscle protein synthesis, improves strength, and reduces recovery time after intense exercise.
  • Mechanisms: Activates the PI3K-Akt-mTOR signaling pathway to drive anabolic processes¹.
  • Applications: Strength training, athletic performance, and recovery from muscle wasting conditions.

Tissue Repair and Cellular Regeneration

  • Key Findings: IGF-1 LR3 promotes the proliferation of satellite cells and supports collagen synthesis, aiding in tissue healing.
  • Mechanisms: Enhances cell division and extracellular matrix production³.
  • Applications: Injury recovery, tendon repair, and post-surgical rehabilitation.

Metabolic Health Optimization

  • Key Findings: IGF-1 LR3 improves glucose metabolism and insulin sensitivity, promoting overall metabolic efficiency⁴.
  • Mechanisms: Enhances glucose uptake and reduces hepatic glucose output⁵.
  • Applications: Insulin resistance, type 2 diabetes, and metabolic syndrome.
Section divider line

Structure

  • Sequence: MFPAMPLSSLRAALRLLGGPEPEGSSDLLTLLGGGGHAVRFPQSWQSRG
  • Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
  • Molecular Weight: ~9,200 Da
  • PubChem CID: Not applicable (synthetic peptide).
Chemical structure diagram of IGF-1 LR3, showing the detailed arrangement of atoms and chemical bonds in its molecular formula, including rings and various functional groups.
Section divider line

Citations for IGF-1 LR3

Muscle Growth and Performance

  1. Adams, G. et al. The Role of IGF-1 in Muscle Anabolism and Recovery. (2012).
  2. Gundersen, K. et al. Extended Half-Life and Anabolic Effects of IGF-1 LR3. (2015).

Tissue Repair and Cellular Regeneration

  1. Robertson, T. et al. IGF-1 LR3 in Cellular Proliferation and Tissue Repair. (2018).
  2. Zhang, Y. et al. Applications of IGF-1 LR3 in Regenerative Medicine. (2017).

Metabolic Health Optimization

  1. Højlund, K. et al. The Role of IGF-1 in Metabolic Health and Insulin Sensitivity. (2019).
  2. Wang, J. et al. IGF-1 Derivatives and Glucose Metabolism Improvements. (2020).

**Note:** This product is intended for research purposes only and not for human consumption. Always consult with a healthcare professional before starting any new supplement or research product.

Researched Pairings

CJC-1295/Ipamorelin (No DAC) Blend

CORE STRENGTH

A clear glass vial with a gold cap, labeled “CJC-1295/Ipamorelin (No DAC) Blend 5mg/5mg,” containing white powder at the bottom.

$120.00

View
Buy This product has multiple variants. The options may be chosen on the product page

GHK-Cu

SKIN RENEWAL

A small clear glass vial with a gold cap labeled “GHK-Cu 50mg” and displaying a green stylized logo on a white background. The vial is used for holding a chemical or medical substance.

$95.00

View
Buy This product has multiple variants. The options may be chosen on the product page

Lean Muscle Mass Peptide Stack

The Lean Muscle Mass Peptide Stack includes three clear glass vials with gold caps labeled TB-500, C1295 + Ipamorelin, and IGF-1 LR3, each featuring dosage info and a green symbol on white labels.

$805.00

View
Buy

Tesamorelin

CORE STRENGTH

Tesamorelin 10mg 1L: A clear glass vial with a gold and white cap, containing white powder. The vial features a green logo on a white label.

$145.00

View
Buy This product has multiple variants. The options may be chosen on the product page

TB-500 (Thymosin Beta-4)

HEALING & REPAIR

A small glass vial with a gold cap, labeled “TB-500 (Thymosin Beta-4) 10 mg/2 ml” in green text, features a stylized green symbol above the label, and is isolated on a white background.

$165.00

View
Buy This product has multiple variants. The options may be chosen on the product page