BATCH

PURITY

99% HPLC

IGF-1 LR3

PerformanceThe Growth-Promoting Peptide for Enhanced Recovery

$187.00

Volume Pricing Guide

QUANTITY PRICE PER
1 $187.00
2 - 4 $168.30
5 - 9 $158.95
10 - 14 $149.60
15 - 19 $140.25
20 + $130.90

Only the lyophilized product is provided. For research use only. All supplies sold separately.  

Summary

IGF-1 LR3 (Insulin-like Growth Factor-1 Long R3) is a synthetic peptide with powerful anabolic effects. IGF-1 LR3 stimulates muscle growth, accelerates recovery, and promotes cellular repair. It is widely studied for its ability to improve physical performance, support tissue regeneration, and optimize metabolic health.

Description & Pharmacodynamics

IGF-1 LR3 is a modified form of IGF-1, a naturally occurring growth factor structurally similar to insulin. It binds to IGF-1 receptors on cells, activating pathways that promote growth, repair, and metabolic efficiency¹. The LR3 modification extends its half-life to approximately 20-30 hours, allowing for sustained anabolic effects and better systemic distribution².

Unlike IGF-1, IGF-1 LR3 is less likely to bind to IGF-binding proteins (IGFBPs), which enhances its availability for cellular uptake³. This modification amplifies its ability to stimulate protein synthesis, promote cell division, and improve glucose metabolism⁴. Additionally, IGF-1 LR3 supports tissue repair by encouraging the proliferation of satellite cells and fibroblasts, making it highly beneficial for recovery from injuries and intense training sessions⁵.

Research Insights

Muscle Growth and Performance

  • Key Findings: IGF-1 LR3 enhances muscle protein synthesis, improves strength, and reduces recovery time after intense exercise.
  • Mechanisms: Activates the PI3K-Akt-mTOR signaling pathway to drive anabolic processes¹.
  • Applications: Strength training, athletic performance, and recovery from muscle wasting conditions.

Tissue Repair and Cellular Regeneration

  • Key Findings: IGF-1 LR3 promotes the proliferation of satellite cells and supports collagen synthesis, aiding in tissue healing.
  • Mechanisms: Enhances cell division and extracellular matrix production³.
  • Applications: Injury recovery, tendon repair, and post-surgical rehabilitation.

Metabolic Health Optimization

  • Key Findings: IGF-1 LR3 improves glucose metabolism and insulin sensitivity, promoting overall metabolic efficiency⁴.
  • Mechanisms: Enhances glucose uptake and reduces hepatic glucose output⁵.
  • Applications: Insulin resistance, type 2 diabetes, and metabolic syndrome.

Structure

  • Sequence: MFPAMPLSSLRAALRLLGGPEPEGSSDLLTLLGGGGHAVRFPQSWQSRG
  • Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
  • Molecular Weight: ~9,200 Da
  • PubChem CID: Not applicable (synthetic peptide).

Citations for IGF-1 LR3

Muscle Growth and Performance

  1. Adams, G. et al. The Role of IGF-1 in Muscle Anabolism and Recovery. (2012).
  2. Gundersen, K. et al. Extended Half-Life and Anabolic Effects of IGF-1 LR3. (2015).

Tissue Repair and Cellular Regeneration

  1. Robertson, T. et al. IGF-1 LR3 in Cellular Proliferation and Tissue Repair. (2018).
  2. Zhang, Y. et al. Applications of IGF-1 LR3 in Regenerative Medicine. (2017).

Metabolic Health Optimization

  1. Højlund, K. et al. The Role of IGF-1 in Metabolic Health and Insulin Sensitivity. (2019).
  2. Wang, J. et al. IGF-1 Derivatives and Glucose Metabolism Improvements. (2020).

**Note:** This product is intended for research purposes only and not for human consumption. Always consult with a healthcare professional before starting any new supplement or research product.

Researched Pairings